PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00124297001
Common NameGSBRNA2T00124297001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 322aa    MW: 36838.5 Da    PI: 6.2844
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00124297001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-321164255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prl+Wt+eLH+rFveav+qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  GSBRNA2T00124297001 11 PRLKWTCELHHRFVEAVNQLGGPNKATPKSLMKAMEIPGLTLYHLKSHLQKYRL 64
                         9****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-28864IPR009057Homeodomain-like
SuperFamilySSF466892.33E-15964IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-221065IPR006447Myb domain, plants
PfamPF002496.3E-71263IPR001005SANT/Myb domain
PfamPF143797.4E-21113159IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSLVLSTDAN PRLKWTCELH HRFVEAVNQL GGPNKATPKS LMKAMEIPGL TLYHLKSHLQ  60
KYRLGKSLKF DDNRLEVSSA LETQEAESGN YSRDFRGSVN EENNNPANDR GLKITEALQL  120
QTEVQKKLHE QIEVQRNLQV KIEAQGKYLQ SVLMKAQQTL AGYTSSTLGM DFSRTKLSRF  180
ASLVNPSSSF SELTQVEEYE EEAEDARESF LYRKKTENRG IKLLRCSVES FLESSESSET  240
KRNNDNDERI SVELPLMEIK SEVMTDKKKR NHNDVVCMEC QLLKKIDFEV DDDEQELKLS  300
LNSYKKNYGD VPEPKKRLGF N*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00124297001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652227.10.0PREDICTED: uncharacterized protein LOC106357085
SwissprotQ9SAK56e-48APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078F6P60.0A0A078F6P6_BRANA; BnaA07g24220D protein
STRINGBra003993.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38782759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.21e-148G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]